All Primary Antibodies
Primary antibodies, immunoglobulins that bind to specific proteins or other biomolecules, are used in many research applications and protocols to detect targets of interest. They are developed using different animal hosts, including mouse, rat, rabbit, goat, sheep, and many others.
Monoclonal and Polyclonal Antibodies
One type of primary antibodies, monoclonal antibodies, provides high reproducibility and low cross-reactivity and background noise. Another type, polyclonal antibodies, often costs less and provides greater affinity and quicker binding. Both are produced using plasma B cells, but the former uses the same clone and the latter uses different clones. Monoclonal antibodies require hybridoma cell lines, and polyclonal antibodies do not.
There are also recombinant monoclonal antibodies with similar benefits, like high affinity, scalability, and specificity. They are produced using in vitro cloning of plasma B cells and expression hosts.
Conjugated Primary Antibodies
Antibodies can be labeled with various fluorophores or detection agents or used without labels. Labeled primary antibodies, also known as conjugated primary antibodies, help researchers simplify and streamline their applications. They are coupled with common enzymes and dyes such as Alexa Fluor and often used in protein and cell analysis.
Applications
Antibodies for life sciences applications are used in flow cytometry, western blotting, ELISA, immunohistochemistry, and immunocytochemistry. Secondary antibodies can be added to support the detection and purification of certain antigens. They bind to the primary antibody, which binds to the antigen of interest. Finding the right combination of antibodies can result in greater antigen specificity and a strong, detectable signal.
- (1)
- (7)
- (2)
- (3,051)
- (925)
- (1,939)
- (4,412)
- (1)
- (1)
- (3)
- (1)
- (1,258)
- (1,754)
- (921,451)
- (21,592)
- (2)
- (774)
- (61)
- (1)
- (29)
- (1)
- (5,588)
- (3,360)
- (1,862)
- (218)
- (1)
- (8,787)
- (12,059)
- (2,271)
- (9)
- (51)
- (3)
- (4)
- (13)
- (2)
- (69)
- (5)
- (4)
- (12,287)
- (15,789)
- (10,955)
- (1)
- (1)
- (4)
- (1)
- (239)
- (78)
- (13)
- (2,669)
- (535)
- (1)
- (1)
- (136)
- (422)
- (3)
- (1)
- (16)
- (108)
- (1)
- (189,950)
- (288,082)
- (1)
- (19)
- (798)
- (1)
- (12,208)
- (2)
- (126)
- (1)
- (2)
- (5)
- (11)
- (4)
- (9)
- (1)
- (2)
- (12)
- (34)
- (3)
- (1)
- (4)
- (1)
- (108)
- (1)
- (20)
- (19)
- (46)
- (1)
- (5)
- (1)
- (1)
- (10,751)
- (652)
- (1)
- (2)
- (1)
- (4)
- (6)
- (6)
- (1)
- (8)
- (3)
- (16)
- (2)
- (2)
- (329)
- (359)
- (5)
- (12,965)
- (2)
- (4,299)
- (2,250)
- (1)
- (14)
- (33)
- (1)
- (7)
- (1)
- (6,034)
- (3,898)
- (1)
- (20)
- (1)
- (1)
- (2)
- (40)
- (1)
- (2)
- (1)
- (17,537)
- (16,755)
- (18)
- (1)
- (1)
- (1)
- (5,542)
- (1)
- (2)
- (43)
- (4)
- (13)
- (1)
- (161)
- (747)
- (17)
- (2)
- (3)
- (1)
- (1)
- (2)
- (2,085)
- (1)
- (9)
- (3)
- (1)
- (1)
- (2)
- (6)
- (2)
- (2)
- (104)
- (1)
- (1)
- (3,863)
- (2)
- (20)
- (3)
- (112)
- (1)
- (1)
- (5)
- (2)
- (3)
- (33)
- (1)
- (5)
- (186)
- (2)
- (4,823)
- (12)
- (1)
- (2)
- (5)
- (9)
- (4)
- (3)
- (23)
- (130)
- (8,919)
- (39,656)
- (448)
- (53)
- (1,929)
- (36)
- (7)
- (1)
- (2,676)
- (1)
- (4,471)
- (42)
- (2)
- (2)
- (1)
- (1)
- (4)
- (50)
- (1)
- (1)
- (815)
- (1)
- (1)
- (2)
- (2)
- (32)
- (40)
- (4)
- (6)
- (3)
- (6)
- (1)
- (3)
- (1)
- (3)
- (3)
- (31,159)
- (9)
- (1)
- (29)
- (2,893)
- (74)
- (89)
- (275)
- (2)
- (55)
- (29,965)
- (29,827)
- (6)
- (32,469)
- (15)
- (29,774)
- (45)
- (866)
- (48)
- (595)
- (30,794)
- (1)
- (32,524)
- (1)
- (3)
- (1)
- (73)
- (3)
- (30,317)
- (29,972)
- (3)
- (24,399)
- (24,957)
- (24,931)
- (24,831)
- (24,989)
- (24,794)
- (23)
- (127)
- (5)
- (103)
- (106)
- (2)
- (1)
- (92)
- (6)
- (15)
- (5)
- (34,904)
- (11)
- (3)
- (221)
- (761)
- (1,054)
- (721)
- (777)
- (920)
- (889)
- (1,009)
- (850)
- (1,471)
- (912)
- (835)
- (1,058)
- (1,061)
- (1,056)
- (681)
- (1,087)
- (30,490)
- (90)
- (9)
- (42)
- (17)
- (1)
- (103)
- (1)
- (139)
- (3)
- (79)
- (28,930)
- (28,983)
- (29,280)
- (63)
- (28,999)
- (25,597)
- (1)
- (60)
- (28,922)
- (28,575)
- (28,539)
- (17)
- (9)
- (1)
- (1)
- (7)
- (4)
- (33,651)
- (5)
- (30)
- (1)
- (1)
- (338)
- (735)
- (30,824)
- (1)
- (30,923)
- (27,238)
- (17,685)
- (17,678)
- (27,221)
- (30,927)
- (38)
- (1)
- (47)
- (9)
- (13)
- (2)
- (99)
- (11)
- (22)
- (58)
- (26)
- (127)
- (158)
- (25)
- (84)
- (57)
- (22)
- (54)
- (73)
- (9)
- (65)
- (73)
- (95)
- (84)
- (78)
- (26)
- (60)
- (68)
- (42)
- (57)
- (50)
- (53)
- (98)
- (122)
- (41)
- (58)
- (65)
- (77)
- (71)
- (454)
- (32,844)
- (7)
- (4)
- (311)
- (417)
- (2,778)
- (3,757)
- (24)
- (3)
- (37)
- (214)
- (2,662)
- (155)
- (41)
- (27,786)
- (558)
- (535)
- (6)
- (12)
- (13)
- (5)
- (6)
- (1,229)
- (858)
- (142)
- (536)
- (429)
- (878)
- (402)
- (325)
- (815)
- (756)
- (721)
- (2)
- (630)
- (722)
- (290)
- (752)
- (822)
- (634)
- (807)
- (12)
- (29)
- (116)
- (5)
- (273)
- (250)
- (125)
- (126)
- (94)
- (46)
- (11)
- (6)
- (5)
- (8)
- (3)
- (5)
- (2)
- (56)
- (14)
- (542,383)
- (7)
- (266)
- (49)
- (2)
- (366)
- (68)
- (47)
- (25)
- (271)
- (3)
- (3)
- (4)
- (29,993)
- (30,024)
- (29,977)
- (562)
- (2,884)
- (51)
- (1)
- (15)
- (1,780)
- (726)
- (3)
- (2)
- (6)
- (4)
- (5)
- (111,665)
- (68)
- (123)
- (2,111)
- (31,144)
- (221)
- (8)
- (23)
- (597,642)
- (16)
- (1)
- (800,141)
- (84,180)
- (3)
- (45,147)
- (174)
- (1)
- (1)
- (571)
- (2)
- (36)
- (23)
- (187)
- (1,232)
- (3)
- (4)
- (468)
- (98)
- (1)
- (1,429)
- (3)
- (2)
- (7)
- (2)
- (127)
- (2)
- (9)
- (95)
- (164)
- (51)
- (745)
- (5)
- (8,432)
- (7,040)
- (12)
- (2)
- (1)
- (27)
- (27)
- (6)
- (161)
- (292)
- (1)
- (74)
- (2)
- (10,238)
- (43)
- (425)
- (171)
- (2,277)
- (156)
- (6)
- (348)
- (2)
- (1)
- (120)
- (1)
- (9)
- (10)
- (27)
- (84)
- (2)
- (23)
- (1)
- (676)
- (56)
- (8)
- (21)
- (109,131)
- (2)
- (2)
- (57)
- (70)
- (275)
- (18)
- (1,253)
- (6,085)
- (2)
- (7)
- (2)
- (2,152)
- (6)
- (57)
- (432,591)
- (31)
- (20,758)
- (15,649)
- (1,535)
- (377)
- (219)
- (79)
- (10,492)
- (4)
- (170)
- (28)
- (2)
- (28)
- (25)
- (1,047)
- (7)
- (2)
- (9)
- (18)
- (2)
- (1)
- (2)
- (92)
- (10)
- (2)
- (349,361)
- (2,675)
- (43,521)
- (93)
- (2)
- (50)
- (41)
- (1)
- (1)
- (4)
- (167)
- (2)
- (32,330)
- (127)
- (2)
- (1)
- (2)
- (150)
- (893)
- (15,271)
- (3)
- (2)
- (168)
- (30)
- (2)
- (2)
- (10)
- (819)
- (3)
- (2)
- (2)
- (2)
- (2)
- (10)
- (87)
- (64)
- (3)
- (337)
- (1,422)
- (2,837)
- (4)
- (290,142)
- (153,811)
- (191)
- (53)
- (197,210)
- (502,585)
- (77)
- (1,445)
- (43,005)
- (14)
- (267)
- (12,831)
- (529,486)
- (202)
- (609)
- (2)
- (3)
- (551)
- (6)
- (4)
- (211,651)
- (2,647)
- (27)
- (10)
- (51)
- (526)
- (25)
- (270)
- (1,156)
- (1,424)
- (7)
- (8)
- (1,340)
- (4)
- (2)
- (3)
- (25)
- (6,535)
- (1)
- (6)
- (812)
- (32)
- (9)
- (2)
- (434)
- (4)
- (4)
- (2)
- (22)
- (48)
- (1,208)
- (2)
- (16)
- (1,835)
- (1)
- (4)
- (2)
- (261)
- (437)
- (1,278)
- (39)
- (6)
- (43,435)
- (22)
- (1)
- (917)
- (85)
- (835)
- (1,910)
- (5)
- (2)
- (3)
- (2)
- (2)
- (22,381)
- (10)
- (1)
- (4)
- (1,391)
- (9)
- (2)
- (4)
- (136)
- (2)
- (1)
- (2,798)
- (105)
- (3)
- (13)
- (33)
- (1,513)
- (5)
- (2)
- (9,776)
- (4,867)
- (3,679)
- (1)
- (41)
- (11)
- (4,367)
- (2)
- (460)
- (442)
- (4)
- (26)
- (14)
- (52)
- (14)
- (2,576)
- (258)
- (3)
- (1)
- (1)
- (29)
- (13)
- (39)
- (2)
- (1)
- (2)
- (3)
- (1)
- (2)
- (1)
- (1,080,774)
- (3)
- (9,440)
- (19)
- (1)
- (51)
- (10)
- (74)
- (3)
- (3)
- (90)
- (40)
- (106)
- (494)
- (5)
- (728)
- (150)
- (62)
- (882)
- (8)
- (35)
- (8)
- (22)
- (5)
- (4)
- (2)
- (867)
- (2)
- (2,269)
- (51)
- (2)
- (5,097)
- (436)
- (1)
- (4)
- (24)
- (3)
- (4)
- (4)
- (8)
- (1)
- (2)
- (19,896)
- (1,027)
- (2,074)
- (426)
- (62)
- (1,190)
- (4)
- (9)
- (53)
- (9)
- (4)
- (47)
- (8)
- (29,697)
- (821)
- (2)
- (2)
- (4)
- (8)
- (5)
- (1,301)
- (9,923)
- (376)
- (1,447)
- (20)
- (855)
- (4)
- (2)
- (30)
- (2)
- (1)
- (1,022)
- (3)
- (9)
- (1)
- (18)
- (3)
- (2)
- (1,266)
- (3,505)
- (371)
- (2)
- (42)
- (5)
- (3)
- (4)
- (3)
- (6)
- (1,889)
- (12)
- (39)
- (4)
- (2,383)
- (164)
- (135)
- (50)
- (1,477)
- (263)
- (2)
- (14)
- (18)
- (1)
- (21)
- (4,674)
- (173)
- (44)
- (1)
- (2)
- (2)
- (5,218)
- (68)
- (578)
- (300)
- (3)
- (108)
- (1)
- (1,572)
- (43)
- (4)
- (2)
- (9)
- (497)
- (21)
- (352)
- (3)
- (3)
- (6)
- (149)
- (145)
- (1)
- (1,779)
- (126)
- (168)
- (42)
- (3)
- (2)
- (176)
- (1)
- (2)
- (36)
- (3,494)
- (218)
- (407)
- (1)
- (274)
- (240)
- (236)
- (160)
- (9)
- (15)
- (11)
- (5)
- (5,222)
- (308)
- (6)
- (10)
- (1)
- (4)
- (52)
- (23)
- (73)
- (2)
- (28)
- (709)
- (1,433,481)
- (695)
- (9)
- (19)
- (1)
- (5)
- (78)
- (519)
- (89)
- (57)
- (15)
- (80)
- (42)
- (441)
- (524)
- (3)
- (15)
- (4)
- (17)
- (107)
- (9)
- (17)
- (2)
- (24)
- (1)
- (24)
- (2)
- (2)
- (16)
- (59)
- (2)
- (18)
- (2)
- (496)
- (8)
- (1)
- (890)
- (1,201)
- (2)
- (8)
- (4)
- (59)
- (139)
- (4)
- (268)
- (1)
- (13)
- (23,995)
- (90)
- (8)
- (2)
- (3)
- (1)
- (571,297)
- (4,877)
- (1,533)
- (1)
- (254)
- (2)
- (3)
- (30)
- (28)
- (8)
- (798)
- (7,443)
- (5)
- (4)
- (45)
- (1,310)
- (23)
- (279)
- (113)
- (1)
- (143)
- (182)
- (1)
- (3)
- (13)
- (20)
- (62)
- (5)
- (6)
- (9)
- (17)
- (207)
- (18)
- (18,491)
- (545)
- (215)
- (25)
- (1,234)
- (6)
- (1)
- (3)
- (1)
- (3)
- (124)
- (11)
- (5)
- (14,722)
- (155)
- (401)
- (10)
- (4)
- (6)
- (62)
- (10,251)
- (532)
- (4)
- (10)
- (2)
- (338,638)
- (5,177)
- (2)
- (6)
- (399)
- (2)
- (33)
- (2,776)
- (1,119)
- (3)
- (10)
- (30)
- (65)
- (153)
- (57)
- (2)
- (247)
- (31)
- (36)
- (3)
- (951)
- (2)
- (5,182)
- (2)
- (1)
- (15)
- (2)
- (22)
- (1)
- (1)
- (2)
- (13)
- (1)
- (2)
- (1)
- (13)
- (3,894)
- (471)
- (1)
- (2)
- (19)
- (5)
- (6)
- (3)
- (9)
- (54)
- (8)
- (3)
- (1)
- (4)
- (87)
- (10)
- (2)
- (24)
- (2)
- (2)
- (42)
- (3)
- (2)
- (2)
- (23)
- (82)
- (2,570)
- (1)
- (8)
- (23)
- (2)
- (3)
- (1,402)
- (6)
- (22)
- (13)
- (4)
- (4)
- (202)
- (5)
- (1,337)
- (38)
- (6)
- (3)
- (19,928)
- (2)
- (50)
- (2)
- (5)
- (3)
- (148)
- (339)
- (183)
- (2,287)
- (1,820)
- (30)
- (16)
- (2)
- (2)
- (4,513)
- (5)
- (9)
Filtered Search Results
Invitrogen™ Granzyme B Monoclonal Antibody (GrB-7)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
| Content And Storage | 4°C |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Western Blot |
| Form | Liquid |
| Gene Accession No. | P10144 |
| Isotype | IgG2a |
| Concentration | 100 μg/mL |
| Antigen | Granzyme B |
| Gene Symbols | GZMB |
| Regulatory Status | RUO |
| Gene Alias | AI553453; C11; Cathepsin G-like 1; CCP1; CCP-1/C11; CCPI; CGL1; CGL-1; CSPB; CSP-B; Ctla1; Ctla-1; CTSGL1; cytotoxic cell protease 1; cytotoxic serine protease B; Cytotoxic T lymphocyte associated serine esterase 1; cytotoxic T-lymphocyte proteinase 2; cytotoxic T-lymphocyte-associated serine esterase 1; fragmentin; fragmentin 2; fragmentin-2; GLP I; GLP III; GLP-1; granzyme 2; granzyme B; granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1); granzyme B(G,H); Granzyme-2; GranzymeB; granzyme-like protein 1; granzyme-like protein I; GRB; GZB; Gzmb; HLP; human lymphocyte protein; Human lymphocyte protein (Hlp); Lymphocyte protease; Natural killer cell protease 1; OTTHUMP00000028189; RNKP-1; SECT; T-cell serine protease 1-3E |
| Gene | GZMB |
| Product Type | Antibody |
| Gene ID (Entrez) | 3002 |
| Formulation | PBS with 0.1% BSA and 0.1% sodium azide |
| Immunogen | Proprietary Immunogen. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | GrB-7 |
Invitrogen™ ZO-1 Monoclonal Antibody (ZO1-1A12), Alexa Fluor™ 488
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark |
|---|---|
| Target Species | Human,Canine |
| Host Species | Mouse |
| Conjugate | Alexa Fluor 488 |
| Applications | ELISA,Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | O97758, Q07157 |
| Isotype | IgG1 |
| Concentration | 0.5 mg/mL |
| Antigen | ZO-1 |
| Gene Symbols | TJP1 |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | DKFZp686M05161; I79_005485; MGC133289; OTTHUMP00000174520; Tight junction protein 1; tight junction protein 1 (zona occludens 1); tight junction protein ZO-1; Tjp1; zo1; ZO-1; ZO-1 MDCK; zona occludens 1; zona occludens protein 1; zonula occludens 1; zonula occludens 1 protein; zonula occludens protein 1 |
| Gene | TJP1 |
| Product Type | Antibody |
| Gene ID (Entrez) | 403752, 7082 |
| Formulation | PBS with 4mg/mL BSA and 0.1% sodium azide; pH 7.4 |
| Immunogen | Human recombinant ZO-1 fusion protein encompassing amino acids 334-634. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | ZO1-1A12 |
CD278 (ICOS) Monoclonal Antibody (ISA-3), APC, eBioscience™, Invitrogen™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | APC |
| Applications | Flow Cytometry |
| Form | Liquid |
| Isotype | IgG1 κ |
| Gene Accession No. | Q9Y6W8 |
| Concentration | 5 μL/Test |
| Antigen | CD278 (ICOS) |
| Gene Symbols | ICOS |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | Activation-inducible lymphocyte immunomediatory molecule; Ailim; CCLP; CD278; CD28 and CTLA-4-like protein; CD28-related protein 1; CRP-1; CVID1; H4; Icos; inducible costimulator; inducible T cell costimulator; inducible T cell co-stimulator; inducible T-cell costimulator; inducible T-cell co-stimulator; Ly115 |
| Gene | ICOS |
| Product Type | Antibody |
| Gene ID (Entrez) | 29851 |
| Formulation | PBS with BSA and 0.09% sodium azide; pH 7.2 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | ISA-3 |
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human,Mouse |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | P04117, P15090 |
| Isotype | IgG |
| Concentration | 0.5 mg/mL |
| Antigen | FABP4 |
| Gene Symbols | FABP4 |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | 3T3-L1 lipid-binding protein; 422/aP2; adipocyte fatty acid binding protein; Adipocyte lipid binding protein; adipocyte lipid-binding protein; adipocyte protein aP2; adipocyte-type fatty acid-binding protein; AFABP; A-FABP; ALBP; ALBP/Ap2; Ap2; epididymis secretory protein Li 104; FABP4; fatty acid binding protein 4; Fatty acid binding protein 4 adipocyte; fatty acid binding protein 4, adipocyte; fatty acid-binding protein 4; Fatty acid-binding protein, adipocyte; HEL S 104; HEL-S-104; Lbpl; myelin P2 protein homolog; P15; P2 adipocyte protein; Protein 422 |
| Gene | FABP4 |
| Product Type | Antibody |
| Gene ID (Entrez) | 11770, 2167 |
| Formulation | PBS with 0.09% sodium azide; pH 7.2-7.4 |
| Immunogen | Recombinant protein corresponding to amino acids 1-132 of human adipocyte-type fatty acid-binding protein. |
| Classification | Recombinant Superclonal |
| Primary or Secondary | Primary |
| Clone | 2HCLC |
Invitrogen™ PSD93 Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | -20°C, Avoid Freeze/Thaw Cycles |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry (Frozen),Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | Q15700, Q63622, Q91XM9 |
| Isotype | IgG |
| Concentration | 1 mg/mL |
| Antigen | PSD93 |
| Gene Symbols | DLG2 |
| Regulatory Status | RUO |
| Purification Method | Antigen affinity chromatography |
| Gene Alias | A330103J02Rik; B230218P12Rik; B330007M19Rik; channel-associated protein of synapse-110; channel-associated protein of synapses, 110kDa; Chapsyn-1; chapsyn-110; discs large 2; discs large homolog 2; discs large MAGUK scaffold protein 2; discs, large homolog 2; discs, large homolog 2 (Drosophila); discs, large homolog 2, chapsyn-110; disks large homolog 2; DLG2; Dlgh2; Gm1197; Postsynaptic density protein PSD-93; PPP1R58; protein phosphatase 1, regulatory subunit 58; PSD93; PSD-93; synaptic density protein PSD-93 |
| Gene | DLG2 |
| Product Type | Antibody |
| Gene ID (Entrez) | 1740, 23859, 64053 |
| Formulation | PBS with 1mg/mL BSA and 0.05% sodium azide |
| Immunogen | Synthetic peptide corresponding to residues N(352) K L C D K P A S P R H Y S P(366) of human PSD-93. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ Rotavirus Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Sheep Polyclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Virus |
| Host Species | Sheep |
| Conjugate | Unconjugated |
| Applications | ELISA,Immunocytochemistry |
| Form | Liquid |
| Isotype | IgG |
| Concentration | 5 mg/mL |
| Antigen | Rotavirus |
| Regulatory Status | RUO |
| Purification Method | Protein G |
| Gene Alias | Reoviridae |
| Product Type | Antibody |
| Formulation | PBS with 0.09% sodium azide |
| Immunogen | Five serotypes of group A Rotavirus strains Wa (serotype I), DS-1 (serotype II), Ito (III), HOCHI (IV) and 69M (VIII). |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ CYP27B1 Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | -20°C |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry (Paraffin),Western Blot |
| Form | Lyophilized |
| Gene Accession No. | O15528, O35084, O35132 |
| Isotype | IgG |
| Concentration | 500 μg/mL |
| Antigen | CYP27B1 |
| Gene Symbols | CYP27B1 |
| Regulatory Status | RUO |
| Purification Method | Antigen affinity chromatography |
| Gene Alias | 1alpha(OH)ase; 25 hydroxyvitamin D3-1-alpha hydroxylase; 25(OH)D 1alpha-hydroxylase; 25-hydroxyvitamin D(3) 1-alpha-hydroxylase; 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial; 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial precursor (25-OHD-1 alpha-hydroxylase) (25-hydroxyvitamin D3 1-alpha-hydroxylase) (VD3 1A hydroxylase) (P450C1 alpha) (P450VD1-alpha); 25-hydroxyvitamin D3 1alpha-hydroxylase; 25-OHD-1 alpha-hydroxylase; Calcidiol 1-monooxygenase; Cp2b; cy; Cyp1; CYP1alpha; Cyp27b; Cyp27b1; Cyp40; cytochrome p450 27B1; cytochrome P450 40 (25-hydroxyvitamin D3 1 alpha-hydroxylase); cytochrome P450 family 27 subfamily B member 1; cytochrome P450 subfamily XXVIIB (25-hydroxyvitamin D-1-alpha-hydroxylase) polypeptide 1; cytochrome P450 subfamily XXVIIB polypeptide 1; cytochrome P450, 27b1; cytochrome P450, 40 (25-hydroxyvitamin D3 1 alpha-hydroxylase); cytochrome P450, family 27, subfamily B, polypeptide 1; cytochrome P450, subfamily 27b, polypeptide 1; cytochrome P450C1 alpha; Cytochrome P450VD1-alpha; P450c1; P450C1 alpha; P450VD1alpha; P450VD1-alpha; Pddr; VD3 1A hydroxylase; Vdd1; Vddr; VDDRI; VDR |
| Gene | CYP27B1 |
| Product Type | Antibody |
| Gene ID (Entrez) | 114700, 13115, 1594 |
| Formulation | PBS with 5mg BSA and 0.05mg sodium azide |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human CYP27B1 (475-508aa HFEVQPEPGAAPVRPKTRTVLVPERSINLQFLDR). |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ VWF Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | -20°C |
|---|---|
| Target Species | Mouse,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry,Immunohistochemistry (Paraffin),Western Blot |
| Form | Lyophilized |
| Gene Accession No. | Q62935, Q8CIZ8 |
| Isotype | IgG |
| Concentration | 500 μg/mL |
| Antigen | VWF |
| Gene Symbols | VWF |
| Regulatory Status | RUO |
| Purification Method | Antigen affinity chromatography |
| Gene Alias | 6820430P06Rik; AI551257; B130011O06Rik; C630030D09; Coagulation Factor VIII; coagulation factor VIII VWF; EMBL:CAB37852.1}; F8VWF; factor viii related antigen; von Willebrand antigen 2; von Willebrand antigen II; von Willebrand Disease (vWD); von Willebrand factor; Von Willebrand factor homolog; VWD; vwf; vwf {ECO:0000312 |
| Gene | VWF |
| Product Type | Antibody |
| Gene ID (Entrez) | 116669, 22371 |
| Formulation | PBS with 5mg BSA and 0.05mg sodium azide |
| Immunogen | E.coli-derived mouse VWF recombinant protein (Position: M1304-E1452). |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ CX3CR1 Recombinant Superclonal™ Antibody (1HCLC)
Rabbit Recombinant Superclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | P49238 |
| Isotype | IgG |
| Concentration | 0.5 mg/mL |
| Antigen | CX3CR1 |
| Gene Symbols | CX3CR1 |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | Beta chemokine receptor-like 1; CCRL1; chemokine (C-C) receptor-like 1; chemokine (C-X3-C motif) receptor 1; chemokine (C-X3-C) receptor 1; CMKBRL1; CMK-BRL1; CMK-BRL-1; CMKDR1; Cx3c; CX3C chemokine receptor 1; C-X3-C CKR-1; C-X3-C motif chemokine receptor 1; Cx3cr1; Fractalkine receptor; G protein-coupled receptor 13; GPR13; G-protein coupled receptor 13; GPRV28; RBS11; Scyd1; V28 |
| Gene | CX3CR1 |
| Product Type | Antibody |
| Gene ID (Entrez) | 1524 |
| Formulation | PBS with 0.09% sodium azide; pH 7.2-7.4 |
| Immunogen | Peptide corresponding to Human CX3CR1 (aa 6-19). |
| Classification | Recombinant Superclonal |
| Primary or Secondary | Primary |
| Clone | 1HCLC |
Invitrogen™ Prodynorphin Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Guinea Pig Polyclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Mouse,Rat |
| Host Species | Guinea Pig |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry (Frozen) |
| Form | Liquid |
| Gene Accession No. | O35417, P06300 |
| Isotype | IgG |
| Concentration | 1 mg/mL |
| Antigen | Prodynorphin |
| Gene Symbols | Pdyn |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | ADCA; Alpha-neoendorphin; beta-neoendorphin; Beta-neoendorphin-dynorphin; Big Dyn; Big dynorphin; Dyn; Dyn-A17; Dyn-B; Dynorphin A(1-13); dynorphin A(1-17); Dynorphin A(1-8); Dynorphin B; Dynorphin B(1-13); Dynorphin B-29; Leu-enkephalin; leumorphin; neoendorphin-dynorphin-enkephalin prepropeptide; PDYN; PENKB; Preprodynorphin; preproenkephalin B; prodynorphin; proenkephalin B; proenkephalin-B; Rimorphin; SCA23; unnamed protein product |
| Gene | Pdyn |
| Product Type | Antibody |
| Gene ID (Entrez) | 18610, 29190 |
| Formulation | PBS with 30% glycerol and 0.05% sodium azide |
| Immunogen | SQENPNTYSEDLDV. Corresponding to residues 235-248 of the rat proDynorphin. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
CD33 Monoclonal Antibody (WM-53 (WM53)), PE-Cyanine7, eBioscience™, Invitrogen™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | PE-Cyanine7 |
| Applications | Flow Cytometry |
| Form | Liquid |
| Isotype | IgG1 κ |
| Gene Accession No. | P20138 |
| Concentration | 5 μL/Test |
| Antigen | CD33 |
| Gene Symbols | CD33 |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | CD33; CD33 antigen; CD33 antigen (gp67); CD33 molecule; CD33 molecule transcript; FLJ00391; gp67; Myeloid cell surface antigen CD33; p67; sialic acid binding Ig-like lectin 3; sialic acid-binding Ig-like lectin 3; SIGLEC3; Siglec-3 |
| Gene | CD33 |
| Product Type | Antibody |
| Gene ID (Entrez) | 945 |
| Formulation | PBS with BSA and 0.09% sodium azide; pH 7.2 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | WM-53 (WM53) |
CD19 Monoclonal Antibody (SJ25C1), PE-Cyanine7, eBioscience™, Invitrogen™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | PE-Cyanine7 |
| Applications | Flow Cytometry |
| Form | Liquid |
| Isotype | IgG1 κ |
| Gene Accession No. | P15391 |
| Concentration | 5 μL/Test |
| Antigen | CD19 |
| Gene Symbols | Cd19 |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | AW495831; B4; B-lymphocyte antigen CD19; B-lymphocyte surface antigen B4; Cd19; CD19 antigen; CD19 molecule; CVID3; differentiation antigen CD19; Leu-12; T-cell surface antigen Leu-12 |
| Gene | Cd19 |
| Product Type | Antibody |
| Gene ID (Entrez) | 930 |
| Formulation | PBS with BSA and 0.09% sodium azide; pH 7.2 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | SJ25C1 |
FOXP3 Monoclonal Antibody (FJK-16s), PE-Cyanine7, eBioscience™, Invitrogen™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rat Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
|---|---|
| Target Species | Bovine,Canine,Feline,Mouse,Pig,Rat |
| Host Species | Rat |
| Conjugate | PE-Cyanine7 |
| Applications | Flow Cytometry |
| Form | Liquid |
| Isotype | IgG2a κ |
| Gene Accession No. | Q99JB6 |
| Concentration | 0.2 mg/mL |
| Antigen | FOXP3 |
| Gene Symbols | Foxp3 |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | AIID; DIETER; forkhead box P3; forkhead box protein P3; Forkhead box protein P3 41 kDa form; Forkhead box protein P3, C-terminally processed; forkhead/winged helix transcription factor 3; Foxp3; FOXP3delta7; immune dysregulation, polyendocrinopathy, enteropathy, X-linked; immunodeficiency, polyendocrinopathy, enteropathy, X-linked; IPEX; JM2; MGC141961; MGC141963; PIDX; regulatory protein Foxp3; RGD1562112; RP23-54C14.1; scurfin; scurfy; sf; XPID |
| Gene | Foxp3 |
| Product Type | Antibody |
| Gene ID (Entrez) | 100037405, 20371, 317382, 444998, 491876, 506053 |
| Formulation | PBS with 0.09% sodium azide; pH 7.2 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | FJK-16s |
Invitrogen™ BIK Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | -20°C |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Flow Cytometry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry |
| Form | Lyophilized |
| Gene Accession No. | O70337, Q13323 |
| Isotype | IgG |
| Concentration | 500 μg/mL |
| Antigen | BIK |
| Gene Symbols | BIK |
| Regulatory Status | RUO |
| Purification Method | Antigen affinity chromatography |
| Gene Alias | apoptosis inducer NBK; apoptosis-inducing NBK; BBC1; BCL2 interacting killer; bcl-2-interacting killer; BCL2-interacting killer; BCL2-interacting killer (apoptosis-inducing); bhikhari; BIK; Bik-like killer protein; Biklk; BIP 1; BIP1; Blk; BP 4; BP4; cb 60; natural born killer; NBK |
| Gene | BIK |
| Product Type | Antibody |
| Gene ID (Entrez) | 114496, 12124, 638 |
| Formulation | PBS with 5mg BSA and 0.05mg sodium azide |
| Immunogen | E.coli-derived human Bik recombinant protein (Position: M1-R123). |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ CD209 (DC-SIGN) Monoclonal Antibody (eB-h209), PE-Cyanine7, eBioscience™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rat Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
|---|---|
| Target Species | Human |
| Host Species | Rat |
| Conjugate | PE-Cyanine7 |
| Applications | Flow Cytometry |
| Form | Liquid |
| Gene Accession No. | Q9NNX6 |
| Isotype | IgG2a κ |
| Concentration | 5 μL/Test |
| Antigen | CD209 (DC-SIGN) |
| Gene Symbols | CD209 |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | CD209; CD209 antigen; CD209 antigen-like protein A; CD209 molecule; Cd209a; CD209a antigen; CD209a molecule; Cd209d; CD209d antigen; CDSIGN; Cire; CLEC4L; Clec4m; C-type lectin domain family 4 member L; C-type lectin domain family 4, member L; C-type lectin domain family 4, member M; Dcsign; DC-SIGN; DC-SIGN1; Dc-signr; DC-SIGN-related protein; Dendritic cell-specific ICAM-3-grabbing non-integrin; dendritic cell-specific ICAM-3-grabbing non-integrin 1; dendritic cell-specific intercellular adhesion molecule-3-grabbing non-integrin; dendritic cell-specific intracellular adhesion molecules (ICAM)-3 grabbing non-integrin; HIV gpl20-binding protein; MGC129965; MGC130443; RGD1561104; SIGN-R1; SIGNR5 |
| Gene | CD209 |
| Product Type | Antibody |
| Gene ID (Entrez) | 30835 |
| Formulation | PBS with BSA and 0.09% sodium azide; pH 7.2 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | eB-h209 |